PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462855964
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 258aa    MW: 29195.5 Da    PI: 9.1453
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462855964genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61.1e-30959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  462855964  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
               79***********************************************95 PP

2K-box98.87.9e-33821758100
      K-box   8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                  le + ++++qqe+akL+++i++Lq+++ hl+G+++++LslkeL+qLe++Leks++kiR++K+ell ++i+++ k+e elq++n++Lr+k++e
  462855964  82 PlLEINAQQYYQQESAKLRNQIQMLQNTNMHLVGDSVGNLSLKELKQLESRLEKSISKIRARKSELLATEINYMVKRETELQNDNMDLRTKIAE 175
                45677889***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-32274IPR002100Transcription factor, MADS-box
CDDcd002653.79E-45274No hitNo description
PRINTSPR004045.9E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014865.0E-2486173IPR002487Transcription factor, K-box
PROSITE profilePS5129714.51589179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
SVRATIERYK KAHACGSSSG APLLEINAQQ YYQQESAKLR NQIQMLQNTN MHLVGDSVGN  120
LSLKELKQLE SRLEKSISKI RARKSELLAT EINYMVKRET ELQNDNMDLR TKIAEGEQQL  180
QQVTVARSAT ISMEQMNPFA ALDTKCFFPA APFAALDMKC FLPGTLQLLE AQNQMLVTEL  240
NLGYQLAPPG TDITHHQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q4e-19169169Myocyte-specific enhancer factor 2B
1tqe_R4e-19169169Myocyte-specific enhancer factor 2B
1tqe_S4e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105379.21e-157uncharacterized protein LOC542326
SwissprotQ2QW531e-130MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLB4FPN61e-157B4FPN6_MAIZE; Uncharacterized protein
STRINGGRMZM2G160687_P031e-155(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-86MIKC_MADS family protein